In vivo tumor growth assay All animal studies were conducted according to protocols approved by MD Anderson Cancer Center’s Institutional Animal Care and Use Committee. Jurkat cells (5 × 106 per injection) were re-suspended in sterile PBS and subcutaneously injected into the right flank of 5-week-old CB17/SCID mice (Harlan Laboratories, Indianapolis, IN). When xenograft tumors reached 100 mm3, the mice were given a single intratumoral injection of SC79 concentration peptides (33.9 mg/kg): S20-3, TCR, or vehicle; 4 mice each. The mice were killed 8 days after injection, and

the tumor tissue was harvested. Tumor width (W) and length (L) were measured by calipers, and size was calculated using the

formula www.selleckchem.com/products/JNJ-26481585.html W2× L/2. The tumoricidal activity was evaluated by comparison of tumor size among groups. Statistical analysis The 2-tailed Student’s t test was used to estimate the statistical significance of the differences between results from triplicate samples or experiments, and the results are expressed as mean values ± standard deviations or standard errors, respectively. The level of significance was set at P < 0.05. Results S20-3 peptide induces cell death of BJABK1 cells Our previous studies demonstrated that wild-type ACY-738 mw K1, but not a truncated K1 with the Ig-like domain deleted, binds to Fas and prevents Fas activation by FasL or by an agonistic Fas antibody [8, 10]. To further elucidate K1-mediated regulation of Fas, we designed peptides derived from the Ig-like domain of K1 (Table 1), targeting the K1 binding site on the Fas receptor. Table 1 Protein sequence of the Ig-like domain of human herpesvirus 8 K1 protein and derived peptides K1 Ig-domain   HSLWITWYPQPVLQTLCGQPSNTVTCGQYVTLYCSTSGNYVTVW K1 peptides     20 amino acids S20-1 HSLWITWYPQPVLQTLCGQP (84–103) S20-2 PVLQTLCGQPSNTVTCGQYV

(94–113)   S20-3 SNTVTCGQYVTLYCSTSGNYV (104–124) 10 amino acids S10-1 SNTVTCGQYV (104–113)   S10-2 TVTCGQYVTL (106–115) 8 amino acids S8-1 TVTCGQYV (106–113)   S8-2 VTLYCSTS (113–120) We first investigated whether K1 peptides GPX6 could sensitize the Burkitt’s lymphoma cell line BJAB stably expressing K1 (BJABK1) to Fas-mediated apoptosis. Cells were treated with 100 μM peptide in combination with 200 ng/mL of FasL for 24 hours, followed by analysis of apoptosis by flow cytometry. The combination of S20-3 and S10-1 peptides with FasL showed a significant (2.2- and 2.5-fold, respectively) increase in cell death compared with FasL alone (Figure 1A). No significant differences in apoptosis rates were seen with FasL in combination with other K1-derived peptides shown in Table 1 (20–1, 20–2, S10-2, S8-1, S8-2). Figure 1 A human herpesvirus 8 K1 peptide induces dose-dependent cell death and activates caspase cascade in BJABK1 cells.